Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= reanno::Phaeo:GFF1302 (334 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 201 bits (511), Expect = 2e-56 Identities = 117/280 (41%), Positives = 162/280 (57%), Gaps = 22/280 (7%) Query: 4 IKLESVTKNFGPVEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIRID 63 I ++ V K+FG + ++L I+ GE T +GPSG GK+TLLR+IAGLE SG ++ + Sbjct: 3 IHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVKFN 62 Query: 64 GEDATNIPPAKRGLAMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAALNL 123 GED T ++RG+ VFQ YAL+ HM+V +N+A+ G+ +K R A A + Sbjct: 63 GEDITTQHVSERGVGFVFQHYALFKHMTVFENVAY-----GLTVRPRKTRPSKAEIAEKV 117 Query: 124 TDYL---------DRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRL 174 L DR P QLSGGQRQR+A+ RA+ EP L DEP LDA +R +R Sbjct: 118 HSLLKLVQLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRAELRR 177 Query: 175 EISELHKRLATTMIYVTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFI 234 + LH + T ++VTHDQ EA+ +ADKIVV+ G IEQ G+P E+Y P N FV F+ Sbjct: 178 WLRRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVYDTPSNPFVYEFL 237 Query: 235 GSPKMNLLTGPQAAQHNAATIG----IRPEHLSISETEGM 270 G+ +NL +H +TIG PEH E +G+ Sbjct: 238 GN--VNLFHA--RVKHGHSTIGNIHIPSPEHAGGEEQQGL 273 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 354 Length adjustment: 29 Effective length of query: 305 Effective length of database: 325 Effective search space: 99125 Effective search space used: 99125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory