Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate 202727 SO3631 glycerate dehydrogenase (NCBI ptt file)
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__MR1:202727 Length = 318 Score = 139 bits (349), Expect = 1e-37 Identities = 95/266 (35%), Positives = 140/266 (52%), Gaps = 21/266 (7%) Query: 70 RLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTRE 129 + V + + G N VD+AAA+ LG+ V +VPAY AVA+ IL + + + Sbjct: 67 KYVGVLATGTNVVDIAAAKDLGIVVTNVPAYGHDAVAQMVFAHILHHTQAVAAHHQAVAA 126 Query: 130 G------DFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNPRIQA 183 G DF + L GK +G+IG G IG+ A++ FG ++L + P Sbjct: 127 GQWTSCSDFCFTLMPLQSLKGKTLGLIGYGDIGQQVAKLALAFGMKVLV-NTRTEPAHLP 185 Query: 184 LGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAAL 243 G + + D +L ESDI+SLHCPLT +T LI+AQ L MKP A+LINT RG L++ AAL Sbjct: 186 QGVSWTSRDKVLKESDILSLHCPLTPETNELINAQTLELMKPQALLINTARGGLIDEAAL 245 Query: 244 IEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREA 303 AL G++ + G+DV E P D+ LLS PN+ + H A+ T+EA Sbjct: 246 AVALTQGRV-FAGVDVLSTE----------PPSMDN---PLLSAPNISTSPHNAWATKEA 291 Query: 304 LAAIADTTLDNIAAWQDGTPRNRVRA 329 + + +N+ ++ G RN V + Sbjct: 292 RQNLLNIATENLKSFLQGNIRNCVNS 317 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 318 Length adjustment: 28 Effective length of query: 301 Effective length of database: 290 Effective search space: 87290 Effective search space used: 87290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory