Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate 201943 SO2813 oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file)
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__MR1:201943 Length = 254 Score = 118 bits (295), Expect = 1e-31 Identities = 81/246 (32%), Positives = 127/246 (51%), Gaps = 6/246 (2%) Query: 15 SLKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAG-AESQLLVERLSADGHKACFER 73 +L+GK V GG GIGA IV+ A +GA V F ++ A+SQLLV+ + A G KA + Sbjct: 11 NLQGKVAFVQGGSRGIGAAIVKRLASEGAAVAFTYVSSEAQSQLLVDEVIAQGGKAIAIK 70 Query: 74 VDLTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFC 133 D T+ +++ I GG DI+VNNA +I+ +T W+ ++ N++ +F Sbjct: 71 ADSTEPEAIRRAIRETKAHLGGLDIVVNNAGILIWDSIENLTLEDWERIVNTNVRSVFVA 130 Query: 134 AQAVVPAMRARGGGAIVNLGSI-SWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRA 192 +Q A+ GG I+N+GS + + +Y K+A+ GL + LARDLG I Sbjct: 131 SQEA--ALHMNDGGRIINIGSTNAERIPFVGGAIYGMSKSALVGLAKGLARDLGPRAITV 188 Query: 193 TCVIPGNVRTPRQLKWYSPEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDARLVTGHSY 252 + PG V T + + + I A L E++A+ V F+A +A +TG S Sbjct: 189 NNIQPGPVDT--DMNPDNGDSSEPIKAIGVLGRYGKAEEIASFVAFIAGPEAGYITGASL 246 Query: 253 FVDAGW 258 +D G+ Sbjct: 247 MIDGGF 252 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 254 Length adjustment: 24 Effective length of query: 235 Effective length of database: 230 Effective search space: 54050 Effective search space used: 54050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory