Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate AMB_RS13035 AMB_RS13035 NAD(P)-dependent oxidoreductase
Query= SwissProt::O18404 (255 letters) >FitnessBrowser__Magneto:AMB_RS13035 Length = 248 Score = 117 bits (294), Expect = 2e-31 Identities = 81/257 (31%), Positives = 135/257 (52%), Gaps = 18/257 (7%) Query: 3 KNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL---GDKVVFVPVDV 59 ++ V+L+TGGASG+G T + +A+ GA V++AD+ G + A EL G K FV +DV Sbjct: 4 EDKVALITGGASGIGYCTVKSMAELGADVLIADINVEAGEKAAAELTAKGFKAEFVRLDV 63 Query: 60 TSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGT 119 T + +++ + GRLD+ N AG ++ F N + +V+++N G Sbjct: 64 TDKANIARVKEHVVATRGRLDILCNVAGWGH-IQPFVDNDDAF-----IAKVMSLNLTGP 117 Query: 120 FNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARD 179 +IR LM + + G IVN AS A G +G++ YSA+K ++ + +AR+ Sbjct: 118 IELIRAFFPLM------IEKKTGKIVNVASDAGRVGSLGESVYSAAKGGLIAFSKALARE 171 Query: 180 LSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYEN-- 237 + I + I PG +TP+L + PEK K IP +R G+P E A + + N Sbjct: 172 GARFNINVNAICPGPTDTPLLKSEPEKFLEAFLKVIPM-RRFGQPQEVADSIVFMASNRA 230 Query: 238 PLLNGEVIRIDGALRMM 254 + G+V+ ++G + M+ Sbjct: 231 DYITGQVLSVNGGITMV 247 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 248 Length adjustment: 24 Effective length of query: 231 Effective length of database: 224 Effective search space: 51744 Effective search space used: 51744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory