Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate GFF4203 HP15_4143 3-oxoacyl-(acyl-carrier-protein) reductase
Query= reanno::ANA3:7024897 (256 letters) >FitnessBrowser__Marino:GFF4203 Length = 265 Score = 118 bits (296), Expect = 1e-31 Identities = 83/252 (32%), Positives = 122/252 (48%), Gaps = 12/252 (4%) Query: 10 LQGKTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVTFYH 69 L+GKT+ ++GG GIG + F E+G+ VA +D E + + ADL T+ Y Sbjct: 14 LEGKTVIVTGGGGGIGRAVCLRFAEEGSLVAVLD-RDESTARATADLI-TEAGGRAKAYA 71 Query: 70 CDLVDIAALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLNTNLRHYFFA 129 D+ D A + +A +E DLG +VL+NNA D+ + P+ WDQ + NL Sbjct: 72 ADITDYAMITDTVAAIESDLGVPTVLVNNAGFDRFMPFLKTEPKLWDQLIAVNLTGALNM 131 Query: 130 VQAVRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRIN 189 V P M GGG VIN+ S + +G + Y A KAG +G ++ +A +L + +N Sbjct: 132 HHVVLPGMIAAGGGKVINVASDAARVGSSGESVYAACKAGLVGFSKTVARELATKNVCLN 191 Query: 190 TLTPGWVMTKRQLTHWVDKDTAKHIE-------NNQCIKEYVMPEDIAAMALFLAADDSK 242 + PG T L V +TA + E N +K PED + LA+DD+ Sbjct: 192 VVCPG--PTDTALLKGV-AETAPNPEKLLEAFRNAVPMKRLAQPEDYPGLIALLASDDAN 248 Query: 243 LCTAQNFIVDGG 254 T Q V GG Sbjct: 249 FITGQVISVSGG 260 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 265 Length adjustment: 24 Effective length of query: 232 Effective length of database: 241 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory