Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate GFF3684 HP15_3626 betaine aldehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >FitnessBrowser__Marino:GFF3684 Length = 489 Score = 333 bits (855), Expect = 6e-96 Identities = 180/476 (37%), Positives = 277/476 (58%), Gaps = 9/476 (1%) Query: 23 FINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAPAK 82 F++G + +GETF ++P G+ + +V D + A+E+ARA F WS + + Sbjct: 11 FVHGRFLANSTGETFPVVNPATGQVIYEVEVADESVQQAAIESARAGFAE--WSAMTAIE 68 Query: 83 RKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYDEV 142 R L+R +LR+ +ELA E D GKP ++ ++D+ A A+ + A + Sbjct: 69 RSRILLRAVAILRERNDELAAAEVRDTGKPWQEAEAVDVVTGADAVEFFAGLAPSIEGNQ 128 Query: 143 APTPHDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLTAIR 202 D REP+G+ I WN+P+ +ACWK PALA GN+++ KPSE++P+ A++ Sbjct: 129 QDLGGD-FYYTRREPLGICAGIGAWNYPIQIACWKSAPALACGNAMIFKPSEETPMGAVK 187 Query: 203 IAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNMK 262 +A++ EAG+PAGV NV+ G VG+ L H ++ + FTG K++M A S +K Sbjct: 188 LAEIFTEAGVPAGVFNVVQGAAE-VGQWLTHHPEIAKVSFTGEVATGKKVMA-AASSTLK 245 Query: 263 RIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLPMV 322 + +E GGKSP I+F DA DL+ A AA + QGE+CT G+R+ V + +F+ + Sbjct: 246 DVTMELGGKSPLIIFDDA-DLENAISAAMVGNFYTQGEICTNGTRVFVHEDLYPRFIERL 304 Query: 323 VEALKG-WKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEET--G 379 +E + KPG+P++P T GAL+ + + VL YI G +GA L GG+ E G Sbjct: 305 LERTRNNIKPGDPMNPDTNFGALISAKHRDLVLDYIAKGLSEGATLSHGGRAFEPEDSKG 364 Query: 380 GTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTSDIS 439 G +VEPTIF T+ M I +EEIFGPV+SV+ F +E +A AN+T GLAAG++T+DI Sbjct: 365 GYFVEPTIFTDCTDDMTIVKEEIFGPVMSVLTFRDEDEVIARANNTDTGLAAGVFTNDIR 424 Query: 440 KAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATWI 495 +AH+ ++AG W+N Y P GG+K SG GR+ + YT++K+ ++ Sbjct: 425 RAHRVIHQIQAGICWINSYGASPAEMPVGGYKLSGIGRENGRETIAHYTQIKSVYV 480 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 32 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 489 Length adjustment: 34 Effective length of query: 463 Effective length of database: 455 Effective search space: 210665 Effective search space used: 210665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory