Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate GFF2976 HP15_2920 amino acid ABC transporter, ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__Marino:GFF2976 Length = 248 Score = 265 bits (676), Expect = 8e-76 Identities = 139/248 (56%), Positives = 178/248 (71%), Gaps = 7/248 (2%) Query: 1 MISIKSINKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 ++ +K +NK++G VL D V++GEV+V+ G SGSGKSTLI+CVN LE ++ G + V Sbjct: 4 IVKMKGMNKYFGKLHVLKDIDLTVEQGEVVVIIGASGSGKSTLIRCVNGLEEYESGTLEV 63 Query: 61 DGTSIADPKTNLPK----LRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKK 116 DG +A PK+ PK +R VGMVFQ F LFPHLT+ N+ +A KV + A Sbjct: 64 DGQQLA-PKSGNPKALAEIRKEVGMVFQQFNLFPHLTVKRNIMLAPKKVKETPETVANAT 122 Query: 117 GLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVL 176 +LL RVG+ A K+P QLSGGQQQRVAIARALAM+P +MLFDEPTSALDPEM+ EVL Sbjct: 123 AERLLNRVGIGNQADKYPSQLSGGQQQRVAIARALAMEPRLMLFDEPTSALDPEMIGEVL 182 Query: 177 DVMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQH 236 DVM +LA EGMTMM VTHEMGFAR+VADRVI++ +G I+E K ++ F N + ERTQ Sbjct: 183 DVMRELAKEGMTMMVVTHEMGFAREVADRVIYIHEGAIVEQGKPDDVFD--NPQNERTQA 240 Query: 237 FLNKILQH 244 FL+++L H Sbjct: 241 FLSRVLAH 248 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 248 Length adjustment: 24 Effective length of query: 220 Effective length of database: 224 Effective search space: 49280 Effective search space used: 49280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory