Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate GFF4122 HP15_4062 spermidine/putrescine ABC transporter, ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__Marino:GFF4122 Length = 373 Score = 241 bits (616), Expect = 2e-68 Identities = 137/299 (45%), Positives = 188/299 (62%), Gaps = 13/299 (4%) Query: 2 TSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIF 61 T +S+ +LS FG TVLD L+L+I GEF+ LLG SGCGK+TLL +AG +G I Sbjct: 4 TLLSLSNLSKQFGGKTVLDGLDLEIYDGEFITLLGPSGCGKTTLLRLMAGFEHPDEGTIT 63 Query: 62 IKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEIL 121 + N+T P++R + VFQ YAL+P M+V N+++GLK+ K P EI +RV A ++ Sbjct: 64 LAGENLTHTAPENRPLNTVFQHYALFPHMSVFDNVAYGLKMEKRPKDEIRQRVDEALAMV 123 Query: 122 QIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQ 181 Q+Q +RKP +LSGGQ+QRVAI RA+V+ + L DEPLS LD KLR ++VE+KRL + Sbjct: 124 QLQDFARRKPHQLSGGQQQRVAIARAVVKRPRLLLLDEPLSALDYKLRRTMQVELKRLQR 183 Query: 182 SLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMNF 241 L T ++VTHDQ EAL+++DR+ V+K G++QQL P +Y P NLF A F+G NF Sbjct: 184 ELGITFVFVTHDQEEALSMSDRVVVLKDGLVQQLGTPREVYERPANLFTARFVG--ETNF 241 Query: 242 FRGEVEPKDGRSFVRAGGIAFDVTAYPAHTR-----LQPGQKVVLGLRPEHVKVDEARD 295 F G VE V+ G I DV R +Q Q + + LRPE ++V E D Sbjct: 242 FPGTVES------VQDGSIKVDVFGLKRTLRRPDFPVQAEQSLHVLLRPEDIRVLEPDD 294 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 373 Length adjustment: 30 Effective length of query: 331 Effective length of database: 343 Effective search space: 113533 Effective search space used: 113533 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory