Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate GFF3984 HP15_3924 short-chain dehydrogenase/reductase SDR
Query= SwissProt::Q92EU6 (254 letters) >FitnessBrowser__Marino:GFF3984 Length = 255 Score = 128 bits (321), Expect = 1e-34 Identities = 76/249 (30%), Positives = 139/249 (55%), Gaps = 5/249 (2%) Query: 10 FNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIK-EDVKDVAAQINPS--RTLALQ 66 F++T KVAV+TG+ GIG+A+A + GA VV+ K E + +A ++ +A+ Sbjct: 6 FDMTGKVAVITGSTKGIGRAIAGEMAVCGAKVVISSRKAEACEQMAEELKAQGFEAMAIP 65 Query: 67 VDITKKENIEKVVAEIKKVYPKIDILA-NSAGVALLEKAEDLPEEYWDKTMELNLKGSFL 125 + +KE+++ +V + + + ID+L N+A + ++ ++ WDK M+ N+K +F Sbjct: 66 CHVGRKEDLQNLVKKTNEAWGSIDVLVCNAATNPVYGPTAEMTDDAWDKIMDTNVKSTFW 125 Query: 126 MAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINV 185 + ++ +M G G +V ++S A + Y SKAA ++ + LA+EW P I + Sbjct: 126 LTNMVLPQMAEKGEGAVVLLSSIAGLRGNTVIGTYGVSKAAEAALARNLAVEWGPKGIRI 185 Query: 186 NAISPTVILTELGKKAWAG-QVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGEN 244 N+I+P +I T+ + W + + + P R G P ++A A+FL + A++ ITG+ Sbjct: 186 NSIAPGLIKTDFARALWEDPERAKQAEDRTPLRRIGDPVDIAGLAVFLSTKASAYITGQV 245 Query: 245 LIIDGGYTI 253 ++ DGG TI Sbjct: 246 IVADGGETI 254 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 255 Length adjustment: 24 Effective length of query: 230 Effective length of database: 231 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory