Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF4155 HP15_4095 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__Marino:GFF4155 Length = 271 Score = 199 bits (506), Expect = 6e-56 Identities = 110/268 (41%), Positives = 161/268 (60%), Gaps = 15/268 (5%) Query: 13 TLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMIT 72 ++L++ +LS+ FGG+ A+ D SF +T +IGPNGAGKT++FNCI+GFYKP G I Sbjct: 2 SILEISNLSLSFGGVKALQDVSFRVPENTVTTIIGPNGAGKTSLFNCISGFYKPQQGTI- 60 Query: 73 FNQKSGKQYLLERLP-DFRITKEARV--ARTFQNIRLFSGLTVLENLLVAQHNKLMKASG 129 +Y + LP + K A + ARTFQNI LF G+TVL+N+ + H + Sbjct: 61 -------RYQGQTLPGSIKPPKRAALGLARTFQNIALFRGMTVLDNIKLGAHVHMKSG-- 111 Query: 130 YTILGLIGVGPYKREA-AEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCT 188 + L GP +RE A ++ ++ ++ P L YG Q+R+E+ARA+ Sbjct: 112 -LLSALAYFGPARREEMAVRKDVEERIIDFLEIDHIRRQPVASLSYGLQKRVELARALAM 170 Query: 189 GPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYG 248 P++L LDEP AG+N E + + IR E G ++L++EHDM +VM+ISDH+ VL +G Sbjct: 171 QPKVLMLDEPVAGMNREEKEDMARFILDIREEWGVTVLMVEHDMGMVMDISDHIAVLNFG 230 Query: 249 QKISDGTPDHVKNDPRVIAAYLGVEDEE 276 Q I++G P V+N+P VI AYLG D E Sbjct: 231 QVITEGLPADVQNNPEVIKAYLGNSDIE 258 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 271 Length adjustment: 26 Effective length of query: 266 Effective length of database: 245 Effective search space: 65170 Effective search space used: 65170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory