Align 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (EC 4.1.2.55) (characterized)
to candidate GFF2223 HP15_2177 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
Query= metacyc::MONOMER-15645 (213 letters) >FitnessBrowser__Marino:GFF2223 Length = 221 Score = 214 bits (544), Expect = 1e-60 Identities = 105/199 (52%), Positives = 143/199 (71%) Query: 11 ILTAGPVVPVIVINKLEHAVPMAKALVAGGVRVLELTLRTECAVEAIRLIAQEVPDAIVG 70 +L + P+VPVI I L+ AVP+ +ALV GG+ VLE+TLRTE ++AI + + +PDA VG Sbjct: 19 VLQSSPLVPVIAIQDLDDAVPLCQALVDGGINVLEITLRTEHGLKAIEEVRKAIPDAWVG 78 Query: 71 AGTVTNPQQLAEVTAAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLR 130 AGTVT+ Q +V AAGAQF I+PG+TE +L+ PL+PGI+T+SE+M+G + G R Sbjct: 79 AGTVTSIAQYRQVEAAGAQFVITPGVTEAILEFGLTSEAPLLPGIATISEMMIGYNLGYR 138 Query: 131 EFKFFPAEANGGVKALQAIAGPFGKIRFCPTGGISLKNYRDYLALKSVLCVGGSWLVPAD 190 EFKFFPAE GG+ AL+A +GPF + FCPTGGI DYLAL +V VGG+WL PAD Sbjct: 139 EFKFFPAEVAGGIPALKAFSGPFPDVTFCPTGGIRRNTAADYLALGNVQAVGGTWLTPAD 198 Query: 191 ALESGDYDRITALAREAVA 209 + + D+ +IT +AR ++A Sbjct: 199 LVAAKDWAQITEIARGSLA 217 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 221 Length adjustment: 22 Effective length of query: 191 Effective length of database: 199 Effective search space: 38009 Effective search space used: 38009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory