Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate GFF2976 HP15_2920 amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__Marino:GFF2976 Length = 248 Score = 278 bits (711), Expect = 8e-80 Identities = 136/243 (55%), Positives = 184/243 (75%), Gaps = 3/243 (1%) Query: 20 LIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQV 79 +++++G+NK++G HVL+DIDL V +GE +V+ G SGSGKSTLIRC+N LE + G+++V Sbjct: 4 IVKMKGMNKYFGKLHVLKDIDLTVEQGEVVVIIGASGSGKSTLIRCVNGLEEYESGTLEV 63 Query: 80 DGIDLAATT---REAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERA 136 DG LA + + A++R ++GMVFQ FNLFPH++V N +LAP V+ A A Sbjct: 64 DGQQLAPKSGNPKALAEIRKEVGMVFQQFNLFPHLTVKRNIMLAPKKVKETPETVANATA 123 Query: 137 RMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLD 196 L++VGI +QA KYPSQLSGGQQQRVAIARAL M+PR+MLFDEPTSALDPEM+ EVLD Sbjct: 124 ERLLNRVGIGNQADKYPSQLSGGQQQRVAIARALAMEPRLMLFDEPTSALDPEMIGEVLD 183 Query: 197 VLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTERAKAFLA 256 V+ +LA GMTM+ VTHEMGFAR+VA+RV+++ G I+E P F+ P+ ER +AFL+ Sbjct: 184 VMRELAKEGMTMMVVTHEMGFAREVADRVIYIHEGAIVEQGKPDDVFDNPQNERTQAFLS 243 Query: 257 QIL 259 ++L Sbjct: 244 RVL 246 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 248 Length adjustment: 24 Effective length of query: 236 Effective length of database: 224 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory