Align Inositol transport system ATP-binding protein (characterized)
to candidate GFF2243 HP15_2193 amino-acid ABC transporter ATP-binding protein-like protein
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Marino:GFF2243 Length = 256 Score = 99.8 bits (247), Expect = 5e-26 Identities = 73/229 (31%), Positives = 120/229 (52%), Gaps = 16/229 (6%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 +IR++G+ K +G L +++ V GE + G +G+GKSTFI+ ++ + + +G I+ Sbjct: 15 IIRVEGMHKWYGDFHVLKDLNLTVDQGERIVICGPSGSGKSTFIRCINRLEEHQQGKIIV 74 Query: 67 EGQPLHFADPR--DAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYA 124 +G L D R D + + V QH + P ++V N + +RK P K A Sbjct: 75 DGIELT-DDVRHIDTVRREVGMVFQHFNLFPHLTVLENCCLSPIWVRKT-PRK-----EA 127 Query: 125 NRITMEEMRKMGINLRGPDQA---VGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGV 181 ME + ++ I PDQA G LSGG++Q VAIARA+ K+++ DEPTSAL Sbjct: 128 EASAMEYLERVKI----PDQANKFPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDP 183 Query: 182 RQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTA 230 VL + ++ G+ ++ +TH + A V DR ++ G+ + A Sbjct: 184 EMIKEVLDVMIELAGSGMTMLCVTHEMGFAKTVADRVIFMDGGEIVEQA 232 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 256 Length adjustment: 24 Effective length of query: 237 Effective length of database: 232 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory