Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate GFF4154 HP15_4094 enoyl-CoA hydratase/isomerase
Query= BRENDA::P77467 (262 letters) >FitnessBrowser__Marino:GFF4154 Length = 264 Score = 169 bits (427), Expect = 7e-47 Identities = 96/250 (38%), Positives = 134/250 (53%), Gaps = 1/250 (0%) Query: 12 GVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRNV 71 GV LT NRPE LN+ N + ++ + +RC++L GAGR F AG D++ Sbjct: 15 GVARLTFNRPEALNAINVPLAEAFLAAVEHINSLSGVRCIVLAGAGRAFMAGGDVSSMAG 74 Query: 72 DPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSAK 131 +G ++ NP + L + PVI AV GVAAGAG +L L D+VIA AK Sbjct: 75 TSEQAGKAIGAILDAV-NPAILLLRSMDAPVIAAVRGVAAGAGLSLTLMADLVIAEEDAK 133 Query: 132 FVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVVDDETLA 191 F++A++ +G +PDCGG+W L G RA L LLG L+A +A +WGM+ +VV Sbjct: 134 FLVAYNGIGAVPDCGGSWALAHKLGAGRAAELMLLGRTLNAGEAKDWGMVNEVVPASEFE 193 Query: 192 DTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADYREGVSAF 251 ++ +A PT G +Q I+ A + L L+ ER R+ D+ EGVSAF Sbjct: 194 SRVNRMIEKVAKGPTRAFGAFRQLIDRANGDRLAAHLEAERVAFLEMTRTEDFAEGVSAF 253 Query: 252 LAKRSPQFTG 261 LAKR F G Sbjct: 254 LAKRPSGFRG 263 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 264 Length adjustment: 25 Effective length of query: 237 Effective length of database: 239 Effective search space: 56643 Effective search space used: 56643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory