Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate GFF4155 HP15_4095 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:A0A159ZWS6 (255 letters) >FitnessBrowser__Marino:GFF4155 Length = 271 Score = 223 bits (567), Expect = 4e-63 Identities = 110/253 (43%), Positives = 165/253 (65%), Gaps = 2/253 (0%) Query: 5 ILKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILL 64 IL++ NLS+ FGG+ A+ V+ V E V +IGPNGAGKT++FNC++GFY+P GTI Sbjct: 3 ILEISNLSLSFGGVKALQDVSFRVPENTVTTIIGPNGAGKTSLFNCISGFYKPQQGTIRY 62 Query: 65 DGEPIQG-LPGHHIARKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGL-FKTPA 122 G+ + G + A G+ RTFQN+ LF+ MT ++N+ + H H+ + + L + PA Sbjct: 63 QGQTLPGSIKPPKRAALGLARTFQNIALFRGMTVLDNIKLGAHVHMKSGLLSALAYFGPA 122 Query: 123 FRKSEREAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDEPAA 182 R+ + E +D + + +P +L+YG Q+R+E+AR + +P++LMLDEP A Sbjct: 123 RREEMAVRKDVEERIIDFLEIDHIRRQPVASLSYGLQKRVELARALAMQPKVLMLDEPVA 182 Query: 183 GLNPKETEDLKALIGVLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTPEQIR 242 G+N +E ED+ I +REE VTVL++EHDM +VM ISDHI V+N G + +G P ++ Sbjct: 183 GMNREEKEDMARFILDIREEWGVTVLMVEHDMGMVMDISDHIAVLNFGQVITEGLPADVQ 242 Query: 243 DNPEVIKAYLGEA 255 +NPEVIKAYLG + Sbjct: 243 NNPEVIKAYLGNS 255 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 271 Length adjustment: 25 Effective length of query: 230 Effective length of database: 246 Effective search space: 56580 Effective search space used: 56580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory