Align Triosephosphate isomerase; TIM; TPI; EC 5.3.1.1; Triose-phosphate isomerase (uncharacterized)
to candidate GFF3332 HP15_3274 thiazole synthase
Query= curated2:Q9YBR1 (223 letters) >FitnessBrowser__Marino:GFF3332 Length = 269 Score = 42.7 bits (99), Expect = 7e-09 Identities = 40/132 (30%), Positives = 58/132 (43%), Gaps = 16/132 (12%) Query: 93 EHKVTYRHLQAVVSKARSL---GLEVLA-CADTPEEAAAAALLRPSMVALEPPELIGTGI 148 E K Y ++ + A L G +V+ C+D P A L VA+ P G Sbjct: 117 EEKTLYPNMTETLVAAEELIKDGFKVMVYCSDDP--LLAKRLEEMGCVAIMP-----LGA 169 Query: 149 PVSQAKPEVITRGVEAVARVAPGVAVLAGAGITAGEDARRAVELGAQGVLVASAVMKAKD 208 P+ + + A V VL AG+ DA A+ELG GVL+ +A+ +AKD Sbjct: 170 PIGSGLGIQNRYNIRLIVENA-NVPVLVDAGVGTASDATIAMELGCDGVLMNTAIAQAKD 228 Query: 209 PHGKMLELAEAM 220 P + +A AM Sbjct: 229 P----IRMANAM 236 Lambda K H 0.316 0.130 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 269 Length adjustment: 24 Effective length of query: 199 Effective length of database: 245 Effective search space: 48755 Effective search space used: 48755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory