Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate GFF4122 HP15_4062 spermidine/putrescine ABC transporter, ATP-binding protein
Query= TCDB::Q00752 (377 letters) >FitnessBrowser__Marino:GFF4122 Length = 373 Score = 233 bits (593), Expect = 8e-66 Identities = 139/373 (37%), Positives = 220/373 (58%), Gaps = 40/373 (10%) Query: 4 LNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKGELK 63 L+L+++ K++ + ++ DL+I + EFI +GPSGCGK+T LR++AG E +G + Sbjct: 6 LSLSNLSKQFGGKT--VLDGLDLEIYDGEFITLLGPSGCGKTTLLRLMAGFEHPDEGTIT 63 Query: 64 IDGEVVNDKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAAQIL 123 + GE + AP++R + VFQ+YAL+PHMSV+DN+A+GLK+ K+ I +RV EA ++ Sbjct: 64 LAGENLTHTAPENRPLNTVFQHYALFPHMSVFDNVAYGLKMEKRPKDEIRQRVDEALAMV 123 Query: 124 GLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHR 183 L +F RKP LSGGQ+QRVA+ RA+V+ ++ L+DEPLS LD KLR +M+ E+ ++ R Sbjct: 124 QLQDFARRKPHQLSGGQQQRVAIARAVVKRPRLLLLDEPLSALDYKLRRTMQVELKRLQR 183 Query: 184 RIGATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANKFVA 243 +G T ++VTHDQ EA++++DR+V++ G V+Q+GTP+E+Y RPAN F A Sbjct: 184 ELGITFVFVTHDQEEALSMSDRVVVLKD----------GLVQQLGTPREVYERPANLFTA 233 Query: 244 GFIGSPAMNFFDVTIKDGHLVSKDGLTIAVTEGQLKMLESKGF---KNKNLIFGIRPEDI 300 F+G NFF T++ +DG G + L F ++L +RPEDI Sbjct: 234 RFVGE--TNFFPGTVES----VQDGSIKVDVFGLKRTLRRPDFPVQAEQSLHVLLRPEDI 287 Query: 301 S----------SSLLVQETYPDATVDA--------EVVVSELLGSETMLY-LKLGQTEFA 341 + +V+ Y +T+D+ EV+ SE + + +LG+ Sbjct: 288 RVLEPDDENGVAGKIVERNYKGSTLDSVIHLADGTEVLASEFFDEDDPAFDYRLGEPVKV 347 Query: 342 ARVDARDFHEPGE 354 + VD ++ P E Sbjct: 348 SWVDGWEWLLPEE 360 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 373 Length adjustment: 30 Effective length of query: 347 Effective length of database: 343 Effective search space: 119021 Effective search space used: 119021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory