Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate GFF2976 HP15_2920 amino acid ABC transporter, ATP-binding protein
Query= uniprot:P70970 (276 letters) >FitnessBrowser__Marino:GFF2976 Length = 248 Score = 135 bits (341), Expect = 7e-37 Identities = 84/215 (39%), Positives = 127/215 (59%), Gaps = 7/215 (3%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISL-GSTVIQAGKKNKDLK 68 L DI+ ++++G V +IG +GSGKSTL++ +NGL + G + + G + K L Sbjct: 20 LKDIDLTVEQGEVVVIIGASGSGKSTLIRCVNGLEEYESGTLEVDGQQLAPKSGNPKALA 79 Query: 69 KLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMNFGVKKED-AEQKAREMLQLVGLSEELL 126 ++RK+VG+VFQ + LF TV ++I P E A A +L VG+ + Sbjct: 80 EIRKEVGMVFQ--QFNLFPHLTVKRNIMLAPKKVKETPETVANATAERLLNRVGIGNQA- 136 Query: 127 DRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTT 186 D+ P +LSGGQ +RVAIA LAM+P +++ DEPT+ LDP E++D+ EL + G +T Sbjct: 137 DKYPSQLSGGQQQRVAIARALAMEPRLMLFDEPTSALDPEMIGEVLDVMRELAKEG-MTM 195 Query: 187 ILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 ++VTH M A AD +I +H+G I G P D+F Sbjct: 196 MVVTHEMGFAREVADRVIYIHEGAIVEQGKPDDVF 230 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 248 Length adjustment: 25 Effective length of query: 251 Effective length of database: 223 Effective search space: 55973 Effective search space used: 55973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory