GapMind for catabolism of small carbon sources

 

Protein Dsui_0637 in Dechlorosoma suillum PS

Annotation: FitnessBrowser__PS:Dsui_0637

Length: 224 amino acids

Source: PS in FitnessBrowser

Candidate for 29 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism aatM hi Glutamate/aspartate import permease protein GltK (characterized) 63% 99% 277.3 Basic amino acid uptake transporter, BgtAB 40% 136.7
L-aspartate catabolism aatM hi Glutamate/aspartate import permease protein GltK (characterized) 63% 99% 277.3 Basic amino acid uptake transporter, BgtAB 40% 136.7
L-glutamate catabolism gltK hi Glutamate/aspartate import permease protein GltK (characterized) 63% 99% 277.3 Basic amino acid uptake transporter, BgtAB 40% 136.7
L-asparagine catabolism natH lo Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale) 35% 52% 133.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-aspartate catabolism natH lo Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale) 35% 52% 133.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-asparagine catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 33% 94% 124.8 Glutamate/aspartate import permease protein GltK 63% 277.3
L-aspartate catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 33% 94% 124.8 Glutamate/aspartate import permease protein GltK 63% 277.3
L-glutamate catabolism gltJ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 33% 94% 124.8 Glutamate/aspartate import permease protein GltK 63% 277.3
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 34% 56% 123.6 Glutamate/aspartate import permease protein GltK 63% 277.3
L-asparagine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 55% 121.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-aspartate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 55% 121.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-glutamate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 55% 121.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-histidine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 55% 121.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-leucine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 55% 121.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-proline catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 55% 121.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-asparagine catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 32% 92% 117.9 Glutamate/aspartate import permease protein GltK 63% 277.3
L-aspartate catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 32% 92% 117.9 Glutamate/aspartate import permease protein GltK 63% 277.3
L-citrulline catabolism PS417_17595 lo ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale) 35% 96% 116.7 Glutamate/aspartate import permease protein GltK 63% 277.3
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 35% 71% 115.5 Glutamate/aspartate import permease protein GltK 63% 277.3
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 35% 71% 115.5 Glutamate/aspartate import permease protein GltK 63% 277.3
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 32% 90% 102.8 Glutamate/aspartate import permease protein GltK 63% 277.3
L-lysine catabolism hisM lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 35% 89% 100.9 Glutamate/aspartate import permease protein GltK 63% 277.3
L-arginine catabolism artM lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 30% 96% 100.5 Glutamate/aspartate import permease protein GltK 63% 277.3
L-histidine catabolism hisM lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 30% 96% 100.5 Glutamate/aspartate import permease protein GltK 63% 277.3
L-arginine catabolism artQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 31% 90% 96.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-histidine catabolism hisQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 31% 90% 96.3 Glutamate/aspartate import permease protein GltK 63% 277.3
L-citrulline catabolism AO353_03050 lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 30% 94% 93.2 Glutamate/aspartate import permease protein GltK 63% 277.3
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 33% 53% 87 Glutamate/aspartate import permease protein GltK 63% 277.3
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 33% 53% 87 Glutamate/aspartate import permease protein GltK 63% 277.3

Sequence Analysis Tools

View Dsui_0637 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MYEFDWSSIPGALPLLGKGLLVTLEVTLTAIVVGIGWGTLLAVARLSSNRLLSFLAAGYV
NLFRSVPLVMVILWFYLIVPQALKGLFGQDIGDIRLVSALVAFALFEAAYYSEIIRAGIQ
SVPKGQVAAGLALGLTPGQTMRLVVLPQAFRNMIPLLLTQAIILFQDTSLVYVIGLSDFF
GTAYKVGDRDGRLVELLLFAGAAYFVICFTVSRLVKHLQARFIK

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory