GapMind for catabolism of small carbon sources

 

Protein Dsui_2068 in Dechlorosoma suillum PS

Annotation: FitnessBrowser__PS:Dsui_2068

Length: 278 amino acids

Source: PS in FitnessBrowser

Candidate for 34 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 43% 88% 169.1 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-lysine catabolism hisP med ABC transporter for L-Lysine, ATPase component (characterized) 41% 89% 160.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-arginine catabolism artP med histidine transport ATP-binding protein hisP (characterized) 42% 85% 157.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-histidine catabolism hisP med histidine transport ATP-binding protein hisP (characterized) 42% 85% 157.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 42% 84% 156.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 42% 84% 156.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-glutamate catabolism gltL med Amino acid ABC transporter ATP binding protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) 40% 88% 156 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 40% 89% 154.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 40% 89% 154.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 45% 77% 152.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 40% 89% 150.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 40% 89% 150.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-alanine catabolism Pf6N2E2_5405 med ABC transporter for D-Alanine, ATPase component (characterized) 40% 85% 149.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 42% 77% 147.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 42% 77% 147.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 42% 77% 147.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-histidine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 42% 77% 147.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 42% 77% 147.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 42% 77% 147.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-histidine catabolism bgtA med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 44% 79% 147.1 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 54% 70% 241.5 Methionine import ATP-binding protein MetN; EC 7.4.2.11 52% 236.9
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 39% 91% 157.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 38% 90% 157.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 35% 73% 119.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-cellobiose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 95% 117.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-glucose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 95% 117.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
lactose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 95% 117.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-maltose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 95% 117.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
sucrose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 95% 117.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
trehalose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 95% 117.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 99% 114 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 99% 114 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 99% 114 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 99% 114 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 54% 241.5

Sequence Analysis Tools

View Dsui_2068 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTTQNTDSPALALRGVSKSFRTPDGQQVGVHPTDLDVAPGEIHGIIGFSGAGKSTLLRLA
NLLERPDAGQVVVHGQDLMTLSPADLRTARQRIGMIFQHFNLLHNRTVADNVAFPLRIAG
ADEARINERVKTCLEFVGLSEKAGVYPAQLSGGQKQRVAIARALAPEPHVLLADEPTSAL
DPRTTQSLLEVLADVNRRLGVTILLVSHEMGVIRRLCHRVSVMEAGQIVERLTIANGRIP
PDSQLAQWLREYGDAEGDAEEAAADPAPQHLLSEAAHG

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory