Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate Dsui_3436 Dsui_3436 beta-hydroxyacid dehydrogenase, 3-hydroxyisobutyrate dehydrogenase
Query= metacyc::MONOMER-15565 (287 letters) >FitnessBrowser__PS:Dsui_3436 Length = 296 Score = 147 bits (371), Expect = 3e-40 Identities = 88/282 (31%), Positives = 145/282 (51%) Query: 4 IGFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKYTIA 63 +GF+G+G+MG+ MA +LL G+ +TVW R + L + GA+V TPAEV ++ + Sbjct: 11 VGFIGLGVMGRPMAGHLLDAGYPLTVWGRRPASTAPLAEMGAAVAATPAEVGRRAEIVFT 70 Query: 64 MLSDPAAALSVVFDKHGALEHICAGKGYIDMSTVDADTSSQISQAITSKGGSFLEAPVSG 123 +++ + SVV + G +E + G +DMST+ + +I+ A+ ++G FL+APVSG Sbjct: 71 VVTSGSDVKSVVLGEAGLIEGLAPGCVVVDMSTIAPGDAREIAAALAARGIHFLDAPVSG 130 Query: 124 SKKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAKMKLVVNMIMGSMMN 183 ++ A L I+A GD + ++V P LGK +G G G K MIM + + Sbjct: 131 GEQGAIHATLAIMAGGDAAVLERVKPLLLRLGKTVVHIGDNGAGQVAKACNQMIMVAAIQ 190 Query: 184 AFSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYPPAFPLKHQQKDMRL 243 A +E + LA SG+D L + L G+ + + ++ G M + + + KD + Sbjct: 191 ACAEAMHLAAASGVDTSRLREALLGGSAGSRVLEVMGERMAERDFAAGIEARLHHKDFGI 250 Query: 244 ALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAVFETL 285 LA P+PVAA + G+G D S++ L Sbjct: 251 LLAEAHALGAPLPVAAQVGQQLNALMGQGMGKDDTSSLLRVL 292 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 296 Length adjustment: 26 Effective length of query: 261 Effective length of database: 270 Effective search space: 70470 Effective search space used: 70470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory