Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate Dsui_3438 Dsui_3438 beta-hydroxyacid dehydrogenase, 3-hydroxyisobutyrate dehydrogenase
Query= metacyc::MONOMER-15565 (287 letters) >FitnessBrowser__PS:Dsui_3438 Length = 299 Score = 130 bits (328), Expect = 3e-35 Identities = 88/289 (30%), Positives = 145/289 (50%), Gaps = 4/289 (1%) Query: 3 EIGFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKYTI 62 EIGF+G+GIMG+ MA+NLL+ G V VW R L++ GA +PA V + + I Sbjct: 2 EIGFIGLGIMGRPMALNLLKGGHGVHVWARRPESMAPLLEAGAVGCSSPAAVAGQVEVVI 61 Query: 63 AMLSDPAAALSVVFDKHG-ALEHICAGKG---YIDMSTVDADTSSQISQAITSKGGSFLE 118 +M++D V+ G A AGK +DMST+ + ++ + ++G F++ Sbjct: 62 SMVADAPDVAQVMLGPDGVAAGAEGAGKHGLVAVDMSTIAPAAARDLAARLQARGVDFVD 121 Query: 119 APVSGSKKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAKMKLVVNMIM 178 APVSG + A G L I+A G + + + +PAF LG+ +G G G K ++ Sbjct: 122 APVSGGEVGAIAGSLSIMAGGSAEAFAKALPAFLCLGQNVVHVGAAGAGQVAKACNQIVT 181 Query: 179 GSMMNAFSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYPPAFPLKHQQ 238 G + A +E A ++G+DP + + L G + + + G M++ ++ P F Q Sbjct: 182 GMGVLAVAEAFNFARQAGVDPAKVREALLGGFAYSRILENHGQRMLERNFKPGFKSWMHQ 241 Query: 239 KDMRLALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAVFETLSK 287 KD+ + + E + +P AAA + F GL + D AV + L + Sbjct: 242 KDLNIVMQSAHELGLCLPGAAATAQMFNAMVGSGLEEEDSVAVLKLLER 290 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 299 Length adjustment: 26 Effective length of query: 261 Effective length of database: 273 Effective search space: 71253 Effective search space used: 71253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory