Align ATPase (characterized, see rationale)
to candidate Dsui_0258 Dsui_0258 sulfate ABC transporter, ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__PS:Dsui_0258 Length = 360 Score = 158 bits (399), Expect = 2e-43 Identities = 95/243 (39%), Positives = 145/243 (59%), Gaps = 9/243 (3%) Query: 22 IYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWI 81 I + K +GN F AL VSL++ GE+V ++GPSG GK+T LR + +E+ G++ Sbjct: 3 IEIRNIAKRFGN-FVALDDVSLSIPTGELVALLGPSGCGKTTLLRIIAGMETADEGQVMF 61 Query: 82 EGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLA-PVQVRRWPVAQAEATAR- 139 EG +H + ++VG VFQ + LF H+ V +N+ V+ R+ ++E R Sbjct: 62 EGSEATH----LHARERQVGFVFQHYALFRHMNVFENVAFGLRVKPRKERPCESEIRKRV 117 Query: 140 -QLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLD 198 LL V++ AD+YP QLSGGQ+QR+A+ARALA++P++LL DEP ALD ++ +E+ Sbjct: 118 MDLLSLVQLDWLADRYPTQLSGGQRQRIALARALAVEPKVLLLDEPFGALDTKVRKELRR 177 Query: 199 VMRDLASE-GMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFL 257 +R L E ++ + TH+ A EVADRVV+M G+I + PD ++ P S QFL Sbjct: 178 WLRRLHDEMHISSVFVTHDQEEALEVADRVVVMNKGRIEQVGSPDEVYSNPASPFVYQFL 237 Query: 258 AQI 260 + Sbjct: 238 GNV 240 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 360 Length adjustment: 27 Effective length of query: 234 Effective length of database: 333 Effective search space: 77922 Effective search space used: 77922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory