Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate Dsui_2068 Dsui_2068 ABC-type metal ion transport system, ATPase component
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__PS:Dsui_2068 Length = 278 Score = 148 bits (374), Expect = 1e-40 Identities = 85/198 (42%), Positives = 122/198 (61%), Gaps = 3/198 (1%) Query: 21 NLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVN--NLVLNHKNKIEICRKYC 78 +L V GE IIG SG+GKST +R N LE +G+VVV+ +L+ + R+ Sbjct: 34 DLDVAPGEIHGIIGFSGAGKSTLLRLANLLERPDAGQVVVHGQDLMTLSPADLRTARQRI 93 Query: 79 AMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYLKVVGLLDKANVYPATLSG 138 M+FQHFNL + TV N+ P+++ + E L+ VGL +KA VYPA LSG Sbjct: 94 GMIFQHFNLLHNRTVADNVAF-PLRIAGADEARINERVKTCLEFVGLSEKAGVYPAQLSG 152 Query: 139 GQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKEISHQSNTTMVVVTHEMGF 198 GQ+QRVAIAR+L + +L DEPTSALDP T Q +L+V+ +++ + T+++V+HEMG Sbjct: 153 GQKQRVAIARALAPEPHVLLADEPTSALDPRTTQSLLEVLADVNRRLGVTILLVSHEMGV 212 Query: 199 AKEVADRIIFMEDGAIVE 216 + + R+ ME G IVE Sbjct: 213 IRRLCHRVSVMEAGQIVE 230 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 278 Length adjustment: 24 Effective length of query: 218 Effective length of database: 254 Effective search space: 55372 Effective search space used: 55372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory