Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate Dsui_0638 Dsui_0638 ABC-type polar amino acid transport system, ATPase component
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__PS:Dsui_0638 Length = 242 Score = 216 bits (551), Expect = 3e-61 Identities = 117/251 (46%), Positives = 168/251 (66%), Gaps = 12/251 (4%) Query: 27 LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLD 86 ++++ + K YG+ +VL + ++G+V+ + G SGSGKST+++C+N LE G I ++ Sbjct: 2 IEIKNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIKCVNGLEPFQQGDIVVN 61 Query: 87 GISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAA 146 G S+ + L LR+ + MVFQHF L+ HMT+ +N+T+A +VL S Sbjct: 62 GTSV----------GDPRTNLSKLRSHVGMVFQHFELFPHMTITDNLTIAQVKVLGRSRE 111 Query: 147 EAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPE 206 EA + LD+VGL + A ++P LSGGQQQRVAIARALAM+P +LFDEPTSALDPE Sbjct: 112 EATDKGLKLLDRVGLKAH-AHKHPGQLSGGQQQRVAIARALAMDPICMLFDEPTSALDPE 170 Query: 207 LVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGR-VEEHGDARILDQPNSE 265 ++ EVL V+ LA+EG TM+ VTHEMGFAR+V+ +V+F+ QGR VE+ +P+SE Sbjct: 171 MINEVLDVMVELAQEGMTMMCVTHEMGFARKVAHRVIFMDQGRIVEDAAKDDFFGKPHSE 230 Query: 266 RLQQFLSNRLK 276 R QQFL+ L+ Sbjct: 231 RAQQFLAKILQ 241 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 242 Length adjustment: 24 Effective length of query: 252 Effective length of database: 218 Effective search space: 54936 Effective search space used: 54936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory