Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate Dsui_0124 Dsui_0124 lactate dehydrogenase-like oxidoreductase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__PS:Dsui_0124 Length = 322 Score = 161 bits (407), Expect = 2e-44 Identities = 107/286 (37%), Positives = 146/286 (51%), Gaps = 13/286 (4%) Query: 39 LKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTES 98 L A I + + I+ A++ +LK ++ + G + D+ R+GIV++N + Sbjct: 40 LAGASIAIVNKLPISGALMARLPQLKMVAVAATGTNNVDLEAARRQGIVVSNIQGYAVHT 99 Query: 99 TADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGV---DVQGKTLGIVGLGRIGGA 155 + VFSL+LA +R ++ + V G WQ + F D+ G TLG+VG G +G Sbjct: 100 VPEHVFSLLLALSRNLLAYRQSVAEGRWQRAEQFCFFDHPIRDLHGATLGVVGGGSLGQG 159 Query: 156 VARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIG 215 V R A F MKVL R Y A A +LA AD + L PLT ET+HLIG Sbjct: 160 VVRLAQ-AFGMKVLQAERKGAAVVRPGYTA----FATVLAEADALSLHCPLTAETRHLIG 214 Query: 216 AAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLK--- 272 AAEL++MK SA+LIN +RG VDE AL AL+ G I GAG DV EP D PLL Sbjct: 215 AAELQAMKPSALLINTARGGLVDEAALARALREGWIAGAGFDVLTAEPPTDDHPLLSPDL 274 Query: 273 --LANVVALPHIGSATHETRHAMARNAAENLVAALDGTLTSNIVNR 316 N + PH+ A+ A+A +NL A G +T NR Sbjct: 275 LAAPNFLLTPHVAWASAPAMQALADQLIDNLEAFARGAMTPGAANR 320 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 322 Length adjustment: 28 Effective length of query: 293 Effective length of database: 294 Effective search space: 86142 Effective search space used: 86142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory