Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate Dsui_2534 Dsui_2534 TRAP transporter, DctM subunit
Query= uniprot:Q88NP0 (426 letters) >FitnessBrowser__PS:Dsui_2534 Length = 429 Score = 271 bits (692), Expect = 4e-77 Identities = 160/426 (37%), Positives = 242/426 (56%), Gaps = 10/426 (2%) Query: 3 AFILLGSFIVLILIGMPVAYALGLSALIGAWWIDIPLQAMMIQVASGVNKFSLLAIPFFV 62 +++L SF L+L+G+P+ A+GL+ L ++ D+ L ++ V +G+ K+ LLAIP FV Sbjct: 2 SWLLFLSFFALMLLGVPLGTAMGLAGLAVVFFGDLGLMSLPTSVYTGIAKYPLLAIPVFV 61 Query: 63 LAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLI 122 LAG I G++ RLV FA LVG RGGL+L I+ G ISGS AD A+V +V+I Sbjct: 62 LAGMIFERSGVALRLVRFAVALVGQRRGGLALAAILVCMVLGGISGSGPADAAAVATVMI 121 Query: 123 PEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLL 182 P M R GYP FS +V + A+L PPS +LYS+ S+ +LF AG++PGLL Sbjct: 122 PSMARAGYPAAFSASVIAAAGSTAILIPPSIVFILYSVLV-PQASVPALFAAGLIPGLLA 180 Query: 183 SAVMMGLCLIFAKKRNY-----PKGEV-IPLREALKIAGEALWGLMAMVIILGGILSGVF 236 +M + + + GE ALK EA WGL+A VIILGG+ SG F Sbjct: 181 GLALMLPAWWLSVRHGFGVAGLQDGEARQSFWSALK---EASWGLLAPVIILGGMRSGAF 237 Query: 237 TATESAAVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLM 296 T TE+A VAV + FV + IYR W+++ +++ + ++VM++I A+ F + + + Sbjct: 238 TPTEAAVVAVFYGLFVGLVIYRTLNWKNIYEVLVESAEVSAVVMLIIALASVFAWAGSTL 297 Query: 297 QIPSKITTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPV 356 + + LS N IL+ + +L++ G +D ++ I P LLPVI G DPV Sbjct: 298 GTFEALGGWLVGLSGNETAILLAVTLLLLIAGMFLDAVSILFIFMPFLLPVILHFGWDPV 357 Query: 357 HFGMIMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPA 416 FG+I+ +N+ IG TPP+ L V S I + IE TV ++ A+ L+ VT++P Sbjct: 358 WFGVILTMNVAIGQFTPPMAINLMVTSRIAGIRIEDTVPWVLWMVGAMLSALLLVTFVPE 417 Query: 417 ISLWLP 422 ++ +P Sbjct: 418 LATGIP 423 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 429 Length adjustment: 32 Effective length of query: 394 Effective length of database: 397 Effective search space: 156418 Effective search space used: 156418 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory