Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate Dsui_0258 Dsui_0258 sulfate ABC transporter, ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__PS:Dsui_0258 Length = 360 Score = 164 bits (416), Expect = 2e-45 Identities = 90/265 (33%), Positives = 148/265 (55%), Gaps = 34/265 (12%) Query: 9 IEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMGLSG 68 IE++N+ K FGN V ++D+SLSI TGE+ ++G SG Sbjct: 3 IEIRNIAKRFGN------------------------FVALDDVSLSIPTGELVALLGPSG 38 Query: 69 SGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHKSVL 128 GK+TL+R + G ++ +G + L R ++ VFQ + L H +V Sbjct: 39 CGKTTLLRIIAGMETADEGQVMFEGSEATHLHA------RERQVGFVFQHYALFRHMNVF 92 Query: 129 DNVAYGLKVRGESKQVCA----ERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALA 184 +NVA+GL+V+ ++ C +R + ++ V L ++YP QLSGG RQR+ LARALA Sbjct: 93 ENVAFGLRVKPRKERPCESEIRKRVMDLLSLVQLDWLADRYPTQLSGGQRQRIALARALA 152 Query: 185 ADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKD 244 + ++L+DE F ALD +R E++ L L +H + VF+THD +EA+ + +R+ ++ Sbjct: 153 VEPKVLLLDEPFGALDTKVRKELRRWLRRLHDEMHISSVFVTHDQEEALEVADRVVVMNK 212 Query: 245 GKLIQVGTPREILHSPADEYVDRFV 269 G++ QVG+P E+ +PA +V +F+ Sbjct: 213 GRIEQVGSPDEVYSNPASPFVYQFL 237 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 360 Length adjustment: 27 Effective length of query: 249 Effective length of database: 333 Effective search space: 82917 Effective search space used: 82917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory