Align Putative enoyl-CoA hydratase protein; EC 4.2.1.17 (characterized, see rationale)
to candidate Dsui_2807 Dsui_2807 enoyl-CoA hydratase/carnithine racemase
Query= uniprot:Q92VJ6 (261 letters) >FitnessBrowser__PS:Dsui_2807 Length = 262 Score = 120 bits (301), Expect = 3e-32 Identities = 80/248 (32%), Positives = 125/248 (50%), Gaps = 4/248 (1%) Query: 14 GVARVTLARSEKHNALSATMIGELTAVVGRLATDASIRAVILDAEGKSFCAGGDLDWMRQ 73 G + L R + N+LS M+ L A + +A D ++R V+L GK+FCAG DL MR Sbjct: 16 GRTTLVLNRPAQFNSLSNAMLETLLAELQSIAADKTVRVVVLQGAGKAFCAGHDLKEMRS 75 Query: 74 QFSADRPTRIAEATRLAMMLKALNDLPKPLIARVHGNAFGGGVGLISVCDTVIAASGAQF 133 D+ A A ++ + ++P+P+IAR+HG A G L+S+CD +AA A+F Sbjct: 76 NH--DKAFMQALFKLCAKVMLTIQEMPQPVIARIHGIATAAGCQLVSMCDLAVAADVAKF 133 Query: 134 GLTETRLGLIPATISPYVIARTGEARARPLFMSARVFGAEEAKVAGFVTTVVDGTMLDGA 193 ++ +GL +T + + G A + ++ A EA+ G V VV LD A Sbjct: 134 AVSGINVGLFCSTPAVGLARNMGRKEALEMLLTGEFIDAGEAQRRGLVNRVVALGDLDEA 193 Query: 194 VEAAVTAYLVAAPGAAGRAKRL-ARSLGLPITDAVIAATIEQLADTWETDEAREGVSAFF 252 VE V + L +P A K++ + L + I +A E +A +A EG+ AF Sbjct: 194 VEHLVQSILAKSPVAVATGKQMFYKQLEMGI-EAAYQYAGEVMACNMMAGDAAEGIDAFI 252 Query: 253 ERRNPSWR 260 E+R P W+ Sbjct: 253 EKRKPVWQ 260 Lambda K H 0.321 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 262 Length adjustment: 25 Effective length of query: 236 Effective length of database: 237 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory