Align Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate Dsui_3239 Dsui_3239 acetyl-CoA acetyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2411 (393 letters) >FitnessBrowser__PS:Dsui_3239 Length = 392 Score = 443 bits (1139), Expect = e-129 Identities = 225/389 (57%), Positives = 282/389 (72%) Query: 5 EIYVVSAARTAIGTFGGSLKDVPLADLATTAVKAALERAAVDPALVGHLVMGNVIPTETR 64 EI V+SA R+A+G FGGSL + A+L VK A+ RA VDP V +GN IPTETR Sbjct: 4 EIVVLSAVRSAVGGFGGSLAGMEPAELGGLVVKEAIARAGVDPKAVTFATVGNCIPTETR 63 Query: 65 DAYISRVAAMNAGIPKETPAYNVNRLCGSGLQAIINAAQTLMLGDADIVVGAGAESMSRG 124 AY++R+A + G+ ++ A+ VNRLCGS +QAI+++AQ +MLGDAD +G G E MSRG Sbjct: 64 YAYVARLATIQGGMSMDSVAFAVNRLCGSAMQAIVSSAQAIMLGDADYAIGGGVEVMSRG 123 Query: 125 PYLMPAARWGSRMGNAQVIDYMLGILHDPFHGIHMGITAENVAARNGITREMQDALAFED 184 YL+PA R G+RMG+ + ID M+ +L DPF HMGITAEN+ + G+TRE QDA A E Sbjct: 124 AYLLPALRSGARMGDTKAIDAMVSVLTDPFGVGHMGITAENLVTKWGLTREEQDAFALES 183 Query: 185 QQRAAHAIANGYFSEQIATVEIQDRKGVKLFSVDEHPRATSLEQLAAMKPAFKKDGSVTA 244 Q RAA AIA G F QI + Q +KG +F DEHPRAT++E LA MK AFKKDGSVTA Sbjct: 184 QNRAAKAIAEGRFKSQIVPITFQTKKGDVVFDTDEHPRATTMEALAKMKAAFKKDGSVTA 243 Query: 245 GNASGLNDGAAALVMASGNAVQANNLKPLARLVSYAHAGVEPEFMGLGPIPATRLALKRA 304 GNASG+ND AA LV+A A KP+ARLVSYA AGV E MG GPIP+++LAL++A Sbjct: 244 GNASGINDAAAFLVLADAAKAAAAGHKPIARLVSYAIAGVPNEIMGEGPIPSSKLALQKA 303 Query: 305 GLTVADLDVIEANIAFAAQACAVSQELDLDPAKVNPNGSGIALGHPVGATGAIIATKAIH 364 GLT+ +D++E+N AFAAQ+ AV++ L LDPAK N NG IALGHPVGATG +I TK +H Sbjct: 304 GLTLDQIDLVESNEAFAAQSLAVAKGLGLDPAKTNVNGGAIALGHPVGATGGVIVTKLLH 363 Query: 365 ELHRTGGRYALVTMCIGGGQGIAAIFERV 393 E+ RTG RY + TMCIGGGQGI I+ER+ Sbjct: 364 EMQRTGARYGMATMCIGGGQGITTIYERI 392 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 392 Length adjustment: 31 Effective length of query: 362 Effective length of database: 361 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory