Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate Dsui_0575 Dsui_0575 electron transfer flavoprotein, alpha subunit
Query= BRENDA::D2RIQ3 (340 letters) >FitnessBrowser__PS:Dsui_0575 Length = 360 Score = 259 bits (661), Expect = 1e-73 Identities = 144/333 (43%), Positives = 196/333 (58%), Gaps = 9/333 (2%) Query: 11 NEKDLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAK---DVPSKLIAR 67 N K +WV VE +GE V +ELLGE RKLAD +L V++ + + + Sbjct: 21 NYKHVWVVVESERGEVHPVSWELLGEGRKLADALGVQLCGVVMCGPGERGAGICGEAFTY 80 Query: 68 GADLVYVCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGL 127 GAD Y+ QD K Y + YT A ++++ YQP + +GA+ GRDL +A + TGL Sbjct: 81 GADKCYLMQDEVLKDYRNEPYTKALTDLVNTYQPEILMLGASTLGRDLAGSVATTLGTGL 140 Query: 128 CADCTILDAE-EDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGE 186 ADCT L E E + TRP GG+++ TI+ + HRPQM TVRP+ E D SR+GE Sbjct: 141 VADCTELVIETETRNLASTRPTFGGSLLCTIMTQRHRPQMATVRPRVMAMPEADGSRSGE 200 Query: 187 VINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPF---VCSGGRGMKAKENFSLLYDLAH 243 ++ VT + E +++ + PF + SGGRG+K ENF L++DLA Sbjct: 201 IVTVPFSMVETSIVTKVL--EFIADDTRDKPNLPFADIIVSGGRGLKKPENFQLVWDLAK 258 Query: 244 ALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCI 303 LG VG SR V G+ E RQVGQSGKTV PK+Y A GISG++QH+ GM +D I+ I Sbjct: 259 VLGAEVGASRPVVQAGWAELDRQVGQSGKTVRPKLYIAAGISGAIQHRVGMDGADVIIAI 318 Query: 304 NKDPDAPMFEISKYGIVGDALKILPLLTAKIKA 336 N D +AP+F+ + YGIVG+A+ ILP LT KA Sbjct: 319 NTDANAPIFDFAHYGIVGNAMTILPALTEAFKA 351 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 360 Length adjustment: 29 Effective length of query: 311 Effective length of database: 331 Effective search space: 102941 Effective search space used: 102941 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory