Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109) (characterized)
to candidate Dsui_3150 Dsui_3150 electron transfer flavoprotein, beta subunit
Query= BRENDA::D2RIQ2 (263 letters) >FitnessBrowser__PS:Dsui_3150 Length = 294 Score = 197 bits (502), Expect = 2e-55 Identities = 114/267 (42%), Positives = 169/267 (63%), Gaps = 12/267 (4%) Query: 1 MNIVVCVKQVPDTAEMKIDPVTNNLVRDGVTNIMNPYDQYALETALQLKDELGAHVTVIT 60 M+IVVC+KQVPD+A++++ PVTN ++R GV I+NPYD +A+E AL LKD+LG VTV+T Sbjct: 1 MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPAIINPYDLFAIEAALALKDQLGGKVTVLT 60 Query: 61 MGPPHAESVLRDCLAVGADEAKLVSDRAFGGADTLATSAAMANTIK--HFGVP-DLILCG 117 MGPP AE LR L+ G DEA LV+D+ F GADTLATS +A+ IK H P DL+ G Sbjct: 61 MGPPQAEPALRKALSYGCDEAVLVTDKLFAGADTLATSYVLASAIKTLHQETPVDLVFTG 120 Query: 118 RQAIDGDTAQVGPEIAEHLGLPQVTAALKVQVKD---DTVVVDRDNEQMSMTFTMKMPCV 174 +Q IDGDTAQVGP +A+ L L +T ++ D +++ V+R E ++P + Sbjct: 121 KQTIDGDTAQVGPGVAKRLELELLTYVSRIVSVDQAANSIRVERRAEGGVQVLETRLPAL 180 Query: 175 VTVMR-SKDLRFASIRGKMKARKAEIPVY--TAAALEIPLDIIGKAGSPTQVMKSF--TP 229 +T++ S ++RF S +A +AE+ V+ AA +E + +G GSPT V + F +P Sbjct: 181 ITMLEGSNEIRFGSAPDMFRAARAEVRVWDRNAAGIE-DIKKVGLKGSPTIVSRVFVPSP 239 Query: 230 KVTQVHGEIFDDEDPAVAVDKLVNKLI 256 + + FD +P A L+++++ Sbjct: 240 RAQKAQQIEFDAANPEAATQTLLDRVL 266 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 294 Length adjustment: 25 Effective length of query: 238 Effective length of database: 269 Effective search space: 64022 Effective search space used: 64022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory