Align L-lysine 6-transaminase (EC 2.6.1.36) (characterized)
to candidate Dsui_0023 Dsui_0023 acetylornithine/succinylornithine aminotransferase
Query= BRENDA::Q5XPV2 (457 letters) >FitnessBrowser__PS:Dsui_0023 Length = 396 Score = 129 bits (325), Expect = 1e-34 Identities = 126/416 (30%), Positives = 183/416 (43%), Gaps = 59/416 (14%) Query: 47 GVWLVDAVTQKRYLDLFSFFASAPLGINPPSIVEDPAFMRELAVAAVNKPSNPDLYSVPY 106 G WLVD KRYLD +A LG P+IVE A + PS P Y+ P Sbjct: 30 GSWLVDQ-QGKRYLDFVQGWAVNCLGHGHPAIVEALASQAGKLI----NPS-PAFYNEPS 83 Query: 107 ARFVKTFARVLGDPRLPRLFFVDGGALAVENALKAALDWKAQKLGLAEPDTDRLQVLHLE 166 +K A + R+FF GA A E A+K A W + G A +++ Sbjct: 84 ---LKLAAGLAAHSCFDRVFFASTGAEANEGAIKLARKWGQKHKGGAH------EIITFA 134 Query: 167 RSFHGRSGYTMSLTNTEPSKTARFPKFGWPRISSPALQHPPAEHTGANQEAERRALEAAR 226 FHGR+ TMS + K GW + +P + P +A+ L++ Sbjct: 135 GGFHGRTLATMSASG----------KPGWDTLFAPQVPGFP--------KAQLNDLDSVA 176 Query: 227 EAFAAADGMIACFIAEPIQGEGGDNHLSAEFLQAMQRLCHENDALFVLDEVQSGCGITGT 286 A + + EPIQGEGG SAEFLQ ++++C + L ++DEVQ+G G TG Sbjct: 177 ---ALINERTVAIMLEPIQGEGGVVPASAEFLQLLRQICDDRGLLLIVDEVQTGMGRTGK 233 Query: 287 AWAYQQLGLQPDLVAFGKKTQVCGVMGGGRIDEVPENVFAVSSRI--------SSTWGGN 338 +A+Q G++PD++ GK G+ GG VP + + T+ GN Sbjct: 234 LFAHQHAGIEPDIMTLGK-----GIGGG-----VPLSALLAKESVCCFEAGDQGGTYNGN 283 Query: 339 LADMVRATRLLETIERTQVFDTVVQRGKYFRDGLEDLAARHPSVVTNARGRGLMCAVDLP 398 +LE + V +G+Y GL+ L+ R + RG+GL+ A+ L Sbjct: 284 PLMTAVGAAVLEVLTAPGFLAEVAAKGEYLGAGLQRLSDR--LGLRGERGQGLLRALLLA 341 Query: 399 DTR--TRNEVLRLMYTEHQVIALPCGGRSLRFRPALTIAEHEIDQALQALASSVTA 452 D R E R E ++ P LRF P+LT++ EIDQ L L + A Sbjct: 342 DERGPAIVEAARERGPEGLLLNAP-RPHLLRFMPSLTVSREEIDQMLAWLEELLRA 396 Lambda K H 0.320 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 396 Length adjustment: 32 Effective length of query: 425 Effective length of database: 364 Effective search space: 154700 Effective search space used: 154700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory