Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate Dsui_2943 Dsui_2943 ABC-type spermidine/putrescine transport system, ATPase component
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__PS:Dsui_2943 Length = 356 Score = 192 bits (487), Expect = 2e-53 Identities = 132/379 (34%), Positives = 198/379 (52%), Gaps = 52/379 (13%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M L+L ++ +RY H V+ I +GPSGCGK+T LR IAG EDI G Sbjct: 1 MAHLELADVMQRY--GAHTVVDGIGFHIEAGVIACLLGPSGCGKTTLLRCIAGFEDIAAG 58 Query: 61 NLYIDDKLMN----DASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRV 116 ++ +D +L++ +P+ R I MVFQ+YAL+PH++V +N+AFGLK K + +RV Sbjct: 59 SIALDGELVSRPGFKLAPEQRRIGMVFQDYALFPHLTVADNIAFGLKT---KGGERQQRV 115 Query: 117 HEAAEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRA 176 +++GL E+ P +LSGGQ+QRVA+ RA+ ++ L+DEP SNLD LR + Sbjct: 116 AAMLDLVGLAGQGEKYPHELSGGQQQRVALARALAPAPRLVLLDEPFSNLDVDLRERLSL 175 Query: 177 EIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNE 236 E+ +I ++ G T I VTHDQ EA +AD I +M GRI+Q TP LY++ Sbjct: 176 EVREILKKAGTTAILVTHDQHEAFAMADEIGVMHE----------GRIQQWDTPYNLYHQ 225 Query: 237 PANKFVAGFIGS----PAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKGYLGK--K 290 PAN+FVA F+G P V+ E + + G+ + G G GK Sbjct: 226 PANRFVADFVGQGVFVPGTVLAGNRVQMELGILESGVPVECSAG-------CGVCGKGCG 278 Query: 291 VTLGIRPEDISSDQ-------IVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTAR 343 V + +RP+D+ D + H+ F ADIL + L S + Sbjct: 279 VDILLRPDDVVHDDKSPLQAAVEHKAFRG----ADILYTLRLES---------GARVLSL 325 Query: 344 VNARDSHSPGEKVQLTFNI 362 V + +H+ GEK+ + ++ Sbjct: 326 VPSHHNHALGEKIGIRLDV 344 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 356 Length adjustment: 30 Effective length of query: 347 Effective length of database: 326 Effective search space: 113122 Effective search space used: 113122 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory