Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Dsui_3464 Dsui_3464 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__PS:Dsui_3464 Length = 263 Score = 152 bits (383), Expect = 1e-41 Identities = 85/211 (40%), Positives = 120/211 (56%), Gaps = 5/211 (2%) Query: 1 MATVTFKDASLSY--PGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVT 58 M+ + KD + PG +K NL + GEF+ L+GPSGCGKST L +AG + + Sbjct: 1 MSDILIKDVQKVFKTPGGDVTALKDINLTVKQGEFVCLLGPSGCGKSTLLNAVAGFQPPS 60 Query: 59 DGAIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDE 118 G I I K + P D MVFQ YAL+P MTV +N+ F L+I K + EI+ V++ Sbjct: 61 AGEIVIEGKKILTPGP---DRGMVFQEYALFPWMTVAQNIAFGLQIQKKEKAEIDLTVNQ 117 Query: 119 AAATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQI 178 L L +F +R PK LSGG RQRVA+ R + + + LMDEP LDA R + ++ Sbjct: 118 LLDLLHLKDFRDRFPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDEL 177 Query: 179 AALQRKLGVTTVYVTHDQTEALTMGDRIAVL 209 + KL T ++VTH E++ + DRI V+ Sbjct: 178 LRIWEKLNKTILFVTHSIEESIYLADRIVVM 208 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 263 Length adjustment: 27 Effective length of query: 349 Effective length of database: 236 Effective search space: 82364 Effective search space used: 82364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory