Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate Dsui_3464 Dsui_3464 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__PS:Dsui_3464 Length = 263 Score = 172 bits (437), Expect = 7e-48 Identities = 92/213 (43%), Positives = 138/213 (64%), Gaps = 8/213 (3%) Query: 1 MTGLLLKDIRKSY----GAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEIT 56 M+ +L+KD++K + G V + I+L +K+GEFV +GPSGCGKSTLL +AG + + Sbjct: 1 MSDILIKDVQKVFKTPGGDVTALKDINLTVKQGEFVCLLGPSGCGKSTLLNAVAGFQPPS 60 Query: 57 GGDMFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRG 116 G++ I+G+++ P + MVFQ YAL+P MTV N+AFG++I ++ K EID V Sbjct: 61 AGEIVIEGKKILTPGPDR---GMVFQEYALFPWMTVAQNIAFGLQIQKKEKAEIDLTVNQ 117 Query: 117 AADMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEI 176 D+L L + DR PK LSGG RQRVAI R + + + L DEP LDA R + E+ Sbjct: 118 LLDLLHLKDFRDRFPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDEL 177 Query: 177 AKLSERMSDTTMIYVTHDQVEAMTLADRIVVLS 209 ++ E++ + T+++VTH E++ LADRIVV++ Sbjct: 178 LRIWEKL-NKTILFVTHSIEESIYLADRIVVMT 209 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 263 Length adjustment: 27 Effective length of query: 335 Effective length of database: 236 Effective search space: 79060 Effective search space used: 79060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory