Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate Dsui_0258 Dsui_0258 sulfate ABC transporter, ATP-binding protein
Query= uniprot:P70970 (276 letters) >FitnessBrowser__PS:Dsui_0258 Length = 360 Score = 129 bits (324), Expect = 9e-35 Identities = 80/219 (36%), Positives = 128/219 (58%), Gaps = 14/219 (6%) Query: 8 LALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDL 67 +AL D++ SI G VA++G +G GK+TLL+ + G+ +GQ+ G + L Sbjct: 16 VALDDVSLSIPTGELVALLGPSGCGKTTLLRIIAGMETADEGQVMF------EGSEATHL 69 Query: 68 KKLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMNFGVKKEDAEQKAR----EMLQLVGLS 122 ++VG VFQ + LF V ++++FG K+ E + R ++L LV L Sbjct: 70 HARERQVGFVFQ--HYALFRHMNVFENVAFGLRVKPRKERPCESEIRKRVMDLLSLVQL- 126 Query: 123 EELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRG 182 + L DR P +LSGGQ +R+A+A LA++P+VL+LDEP LD + RKE+ LH Sbjct: 127 DWLADRYPTQLSGGQRQRIALARALAVEPKVLLLDEPFGALDTKVRKELRRWLRRLHDEM 186 Query: 183 NLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 +++++ VTH E+A AD ++VM+KG I+ GSP +++ Sbjct: 187 HISSVFVTHDQEEALEVADRVVVMNKGRIEQVGSPDEVY 225 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 360 Length adjustment: 27 Effective length of query: 249 Effective length of database: 333 Effective search space: 82917 Effective search space used: 82917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory