Align gluconolactonase (EC 3.1.1.17) (characterized)
to candidate CA265_RS13655 CA265_RS13655 hypothetical protein
Query= BRENDA::Q64374 (299 letters) >FitnessBrowser__Pedo557:CA265_RS13655 Length = 291 Score = 171 bits (434), Expect = 1e-47 Identities = 104/295 (35%), Positives = 152/295 (51%), Gaps = 15/295 (5%) Query: 5 KVECVLRENYRCGESPVWEEASQSLLFVDIPSKIICRWDTVSNQVQRVAVDAPVSSVALR 64 K + + + + GE W Q LF+DI K+I + + +V + A +A Sbjct: 5 KPDVLYKADLILGEGARWHAGWQKFLFIDIKGKLIGTCNPANGKVVTKKISAMPGMLAPA 64 Query: 65 QLGGYVATIGTKFCALNWENQSVFVLAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAP 124 + + + K N LA ED +N R NDG D GR + GTM Sbjct: 65 ENDQLLVALQGKIVLFNLATGKTINLAKFKEDPEN-RSNDGACDALGRLWVGTMNINA-- 121 Query: 125 AVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLQT 184 + G+LY + + K + +SNG+ WS D++ YYIDS Y + AFDYDL T Sbjct: 122 ---KHGAGNLYCY--NGKLVKKIEGTSVSNGICWSQDNRTLYYIDSFLYHIKAFDYDLAT 176 Query: 185 GQISNRRIVYKMEKDEQIPDGMCIDAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDK 244 G ISN RIV ++ + + DGMCID+EG LWVA + G V R +P TG + +++ Sbjct: 177 GNISNERIVVEITEPNTVADGMCIDSEGMLWVAIWGGACVNRYNPLTGACIGKIEINAPN 236 Query: 245 TTSCCFGGKDYSEMYVTCARDGLNAEGLLRQPDAGNIF----KITGLGVKGIAPY 295 TSC FGGK ++M +T A+DGL+A+ L + P +G++F K+TGL APY Sbjct: 237 VTSCAFGGKLMNQMLITTAKDGLSADELKKYPHSGSLFMVKLKVTGLPT---APY 288 Lambda K H 0.319 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 291 Length adjustment: 26 Effective length of query: 273 Effective length of database: 265 Effective search space: 72345 Effective search space used: 72345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory