Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate CA265_RS12240 CA265_RS12240 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Pedo557:CA265_RS12240 Length = 311 Score = 132 bits (333), Expect = 8e-36 Identities = 100/313 (31%), Positives = 148/313 (47%), Gaps = 26/313 (8%) Query: 2 KKIVAWKSLPEDVLAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKIT-------P 54 K ++ +++ E+ LA LQ++ V T +D A LKD + IT Sbjct: 3 KNVLLLETIAEEALALLQENVNVF----TGYDE--AGLKDTLNNVEVHAIITRGKKHIDK 56 Query: 55 AMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRV 114 +++ L+ + VG D DV + + R I + N P + A+ +L+L R + Sbjct: 57 TLMDACPHLEVAARCGVGLDNVDVDEASARKIRVINAPGSNAATIAEHTLALMLMLMRDM 116 Query: 115 VELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRS 174 VK +W A G ++ GKTLGI+GLG IG VA+ F MKVL +RS Sbjct: 117 HRSVNHVKQNNWNWRNQYA--GDELNGKTLGILGLGNIGKRVAKLGD-AFGMKVLCWSRS 173 Query: 175 ANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRG 234 + L E+L +D V L +PL+ ET +IGA++L MK A LIN +RG Sbjct: 174 VQD----------LPLDEVLQQSDVVSLHLPLSNETNEIIGASQLALMKPKAFLINTARG 223 Query: 235 ATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMA 294 A +D AL++AL GTI G DV EP +++ N + PH S T T M Sbjct: 224 ALIDHAALLDALNAGTIAGFAADVLPDEPPLQSLAVVQHPNALVTPHAASLTASTYKQMC 283 Query: 295 RNAAENLVAALDG 307 N+++ L G Sbjct: 284 LLTVRNVLSVLAG 296 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 311 Length adjustment: 27 Effective length of query: 294 Effective length of database: 284 Effective search space: 83496 Effective search space used: 83496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory