GapMind for catabolism of small carbon sources

 

Alignments for a candidate for lacB in Pedobacter sp. GW460-11-11-14-LB5

Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate CA265_RS11590 CA265_RS11590 hypothetical protein

Query= reanno::Pedo557:CA265_RS15360
         (127 letters)



>FitnessBrowser__Pedo557:CA265_RS11590
          Length = 902

 Score = 79.3 bits (194), Expect = 1e-19
 Identities = 39/100 (39%), Positives = 61/100 (61%)

Query: 26  EKTVVATATMTKHAAFQSNPGEKLINKSDCLGCHNKTNKIIGPAYVEIAKKYPATEKNIN 85
           E + +A A +    A Q+  G+ ++ KSDC  CH +    IGPA+ +IA KY    K ++
Sbjct: 625 EGSDLAGAQLGHQQAAQTLVGKTIMLKSDCSTCHKEAAVSIGPAFNKIAAKYKNDSKAVD 684

Query: 86  MLADKIIKGGTGVWGNMPMTAHATLKKDDAKLMVKYILSL 125
            LA K+I G  GVWG +PM AH T+K+ + K + ++I++L
Sbjct: 685 YLASKVIAGSHGVWGEVPMPAHTTMKEAEVKKITEWIMTL 724


Lambda     K      H
   0.317    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 250
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 127
Length of database: 902
Length adjustment: 28
Effective length of query: 99
Effective length of database: 874
Effective search space:    86526
Effective search space used:    86526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory