Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate CA265_RS16230 CA265_RS16230 hypothetical protein
Query= reanno::Pedo557:CA265_RS15360 (127 letters) >FitnessBrowser__Pedo557:CA265_RS16230 Length = 652 Score = 50.4 bits (119), Expect = 4e-11 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 6/100 (6%) Query: 32 TATMTKHAAFQSNPG----EKLINKSDCLGCHNKTNKIIGPAYVEIAKKYPATEKNINML 87 T T K AA P E L+ K+ CL CHN+T + IGP +VEIAK+ + EK ++ Sbjct: 555 TTTPAKPAATAKAPTFKEVEGLLTKNTCLACHNQTKRQIGPPFVEIAKRKYSAEKIFQLI 614 Query: 88 ADKIIKGGTGVWGNMPMTAHATLKKDDAKLMVKYILSLKK 127 + + G MP T K +A + +I SL K Sbjct: 615 HNPQPQNWPGYSTEMPPMPQVT--KAEALKIAGWINSLNK 652 Lambda K H 0.317 0.131 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 127 Length of database: 652 Length adjustment: 25 Effective length of query: 102 Effective length of database: 627 Effective search space: 63954 Effective search space used: 63954 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory