Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate CA265_RS12240 CA265_RS12240 phosphoglycerate dehydrogenase
Query= curated2:Q9YAW4 (335 letters) >FitnessBrowser__Pedo557:CA265_RS12240 Length = 311 Score = 187 bits (476), Expect = 2e-52 Identities = 118/318 (37%), Positives = 173/318 (54%), Gaps = 21/318 (6%) Query: 3 RPRVFVTREVFPEALELLSKYYDVEVWDKYQPPPYETLLSKAREADALYTLLTDRIDCDL 62 R V + + EAL LL + +V V+ Y + L+ E A+ T ID L Sbjct: 2 RKNVLLLETIAEEALALLQE--NVNVFTGYDEAGLKDTLNNV-EVHAIITRGKKHIDKTL 58 Query: 63 LSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPGVLTEATAEFTWALILAAARRVVE 122 + P L + A+ VG DN+DV+ A+ I V N PG AE T AL+L R + Sbjct: 59 MDACPHLEVAARCGVGLDNVDVDEASARKIRVINAPGSNAATIAEHTLALMLMLMRDMHR 118 Query: 123 ADHFVRWGEW-WRLRTGWHPMMMLGVELRGKTLGILGMGRIGSRVAEIGKAFGMRIIYHS 181 + + V+ W WR + G EL GKTLGILG+G IG RVA++G AFGM+++ S Sbjct: 119 SVNHVKQNNWNWRNQYA-------GDELNGKTLGILGLGNIGKRVAKLGDAFGMKVLCWS 171 Query: 182 RSRKREIEKELGAEYRSLEDLLRESDILSIHLPLTDETRHLIGESELKLMKKTAILVNTG 241 RS + L+++L++SD++S+HLPL++ET +IG S+L LMK A L+NT Sbjct: 172 RS----------VQDLPLDEVLQQSDVVSLHLPLSNETNEIIGASQLALMKPKAFLINTA 221 Query: 242 RGAIVDTGALVKALREGWIAAAALDVFEEEPLNPNHPLTAFKNVVLAPHAASATRETRLR 301 RGA++D AL+ AL G IA A DV +EP + + N ++ PHAAS T T + Sbjct: 222 RGALIDHAALLDALNAGTIAGFAADVLPDEPPLQSLAVVQHPNALVTPHAASLTASTYKQ 281 Query: 302 MAMMAAENLVAFAQGKVP 319 M ++ N+++ G+ P Sbjct: 282 MCLLTVRNVLSVLAGQQP 299 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 311 Length adjustment: 28 Effective length of query: 307 Effective length of database: 283 Effective search space: 86881 Effective search space used: 86881 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory