Align BadK (characterized)
to candidate GFF2642 PGA1_c26820 probable enoyl-CoA hydratase PaaG
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Phaeo:GFF2642 Length = 261 Score = 149 bits (375), Expect = 7e-41 Identities = 95/258 (36%), Positives = 135/258 (52%), Gaps = 6/258 (2%) Query: 3 SNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFA 62 S +L E G ITLNRPD LN+ + + AL AL A D G A+++ G R F Sbjct: 2 SETLLVEDHGTWVEITLNRPDRLNSFTEEMHHALRAALEAA-RDGGARAVLLTGAGRGFC 60 Query: 63 AGADIASMAAWSYSDVYGSNFITRNW-----ETIRQIRKPVLAAVAGLAYGGGCELALAC 117 AG D+ R + IR + PV+ AV G+A G G LALAC Sbjct: 61 AGQDLGDRDPRKMDGPPDLGHTVRTFYAPLVNLIRALDFPVICAVNGVAAGAGANLALAC 120 Query: 118 DIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLV 177 D+V+A SAKF K+GL+P GG+ LPR +G+A+A + L+A PL A++A+ +GL+ Sbjct: 121 DVVLAAESAKFIQSFSKVGLIPDTGGSWHLPRLLGEARAKGLALTAEPLPAKKAEDWGLI 180 Query: 178 SRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFAS 237 + V D+ L E A+A A L K+++ A +TL++ + E + S Sbjct: 181 WKAVPDEELMAEARAMAEKFANGPTLGLGLTKQTIQAAAVTTLSDQLEIEADAMKTCGES 240 Query: 238 ADAREGIQAFLEKRAPCF 255 AD EG+ +FLEKR P F Sbjct: 241 ADYAEGVASFLEKRVPAF 258 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory