Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate GFF2619 PGA1_c26600 amino acid ABC transporter, permease protein
Query= TCDB::P48244 (228 letters) >FitnessBrowser__Phaeo:GFF2619 Length = 273 Score = 98.6 bits (244), Expect = 1e-25 Identities = 69/227 (30%), Positives = 118/227 (51%), Gaps = 7/227 (3%) Query: 4 LWADLGPSLLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTP 63 L+ + +L+ +TI +T+ S A + G L S ++R + YI VR P Sbjct: 41 LYLSILSTLMRGVQLTIFVTLISFFLASLLGLGLALAAGSRWLVIRQGARFYIEVVRGIP 100 Query: 64 LTLVVLFCSFGLYQ---NLGLTLAGRESSTFLVDNNFRL---AVLGFILYTSTFVAESLR 117 + +++L+ +F L L L + NF L A++ ++ S F++E R Sbjct: 101 IIVLLLYVAFVLAPALVELRNWLGDHIGLDPIRTRNFPLLWRAIIALMIAYSAFISEVFR 160 Query: 118 SGINTVHFGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGV 177 +G+ +V GQ EAA+SLGL FR I+FPQA+R + PLGN +AL K++++ SV+GV Sbjct: 161 AGLQSVDEGQIEAAKSLGLSRWHRFRFIVFPQAIRTILPPLGNDFVALVKDSSLVSVLGV 220 Query: 178 GEASLLMKATIENHANMLFVVFAIFAVGFMILTLPMGLGLGKLSERL 224 + + L K T + F + + A+ ++ LT+ + L L + + L Sbjct: 221 ADVTQLGKLTAVGNFR-YFETYNVVALIYLTLTIGLSLLLRRFEKHL 266 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 273 Length adjustment: 24 Effective length of query: 204 Effective length of database: 249 Effective search space: 50796 Effective search space used: 50796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory