Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate GFF3831 PGA1_262p02350 histidine transport ATP-binding protein HisP
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Phaeo:GFF3831 Length = 281 Score = 167 bits (422), Expect = 4e-46 Identities = 99/244 (40%), Positives = 147/244 (60%), Gaps = 13/244 (5%) Query: 6 DVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVE 65 D+HK++ + L+ L + G + +IG SG+GKST+LR IN LE P+ G I++ Sbjct: 40 DLHKSFG----SLEVLKGVSLTAKQGDVVAIIGGSGSGKSTMLRCINFLETPNSGEIVIA 95 Query: 66 GEDV------TALDAEGLRRFRQRVGMIFQHFNLLSSKTVADN-IAMPLRLAGGFSRAEV 118 GE V + D + R R R+ M+FQ FNL + +T+ +N I +P+ + R+E Sbjct: 96 GETVAMRQDGSPADRRQIERIRTRLAMVFQQFNLWTHRTLLENVIEVPVHVLK-VPRSEA 154 Query: 119 DARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTA 178 R ELLARVGL D A +PA LSGGQ+QR IARALA P+++L DE TSALDP+ Sbjct: 155 IHRAHELLARVGLGDKADAFPAFLSGGQQQRAAIARALAVDPNVMLFDEPTSALDPELVG 214 Query: 179 SVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTT 238 VL ++ ++ E + T++L+THEM R V + V + G I EQG ++VF +P+ Sbjct: 215 EVLTVIRDLAAEGR-TMLLVTHEMKFAREVANHVVYLFEGRIEEQGPPSEVFGNPKSERL 273 Query: 239 RRFV 242 ++F+ Sbjct: 274 KQFL 277 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 281 Length adjustment: 27 Effective length of query: 308 Effective length of database: 254 Effective search space: 78232 Effective search space used: 78232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory