Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate GFF3831 PGA1_262p02350 histidine transport ATP-binding protein HisP
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Phaeo:GFF3831 Length = 281 Score = 251 bits (642), Expect = 9e-72 Identities = 131/248 (52%), Positives = 177/248 (71%), Gaps = 4/248 (1%) Query: 6 APLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRL 65 A I L K+FG+L+VL+GV+ DV++IIG SG GKST LRC+N LE + G + Sbjct: 33 AEAIRVCDLHKSFGSLEVLKGVSLTAKQGDVVAIIGGSGSGKSTMLRCINFLETPNSGEI 92 Query: 66 EVAGVDLS----GAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMA 121 +AG ++ G+ D++ + ++R R+ MVFQ FNL+ H T+L+N++ P VL++P + Sbjct: 93 VIAGETVAMRQDGSPADRRQIERIRTRLAMVFQQFNLWTHRTLLENVIEVPVHVLKVPRS 152 Query: 122 EAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPEL 181 EA RA L +VGLG KAD +P LSGGQ+QR AIAR L + P ++LFDEPTSALDPEL Sbjct: 153 EAIHRAHELLARVGLGDKADAFPAFLSGGQQQRAAIARALAVDPNVMLFDEPTSALDPEL 212 Query: 182 VGEVLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDR 241 VGEVL V++ LA EG TM +VTHEM+FAREV+N V + +G IEE+G P+EVF NPKS+R Sbjct: 213 VGEVLTVIRDLAAEGRTMLLVTHEMKFAREVANHVVYLFEGRIEEQGPPSEVFGNPKSER 272 Query: 242 LRAFLSRI 249 L+ FLS + Sbjct: 273 LKQFLSSV 280 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 281 Length adjustment: 25 Effective length of query: 227 Effective length of database: 256 Effective search space: 58112 Effective search space used: 58112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory