Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF1570 PGA1_c15920 putative branched-chain amino acid transport ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__Phaeo:GFF1570 Length = 276 Score = 175 bits (444), Expect = 7e-49 Identities = 89/213 (41%), Positives = 143/213 (67%), Gaps = 2/213 (0%) Query: 32 VHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVFEGRDITRMPTHEIARLRIAQS 91 + V+KGEI ++G NGAGKST M + G R+G+V +G DIT++ + + Sbjct: 66 IAVDKGEIAVIVGPNGAGKSTAMKAVFGMLDVRSGAVRLDGEDITQLTPQDRVVKGMGFV 125 Query: 92 PEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFTLFPRLKERHAQRGGTLSGGEQQM 151 P+ IF MTV ENL+MGA + F++ +E+++ LFP L+E+ Q G LSGG++Q Sbjct: 126 PQTSNIFTSMTVEENLEMGAFI-RTDDFSDTMEQVYELFPILREKRNQPAGELSGGQRQQ 184 Query: 152 LSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKLNEAEGLTVFLVEQNAFAALRLS 211 +++GRALM +PK+L+LDEP+ G++P+++ +F+ I ++ GL + +VEQNA AL ++ Sbjct: 185 VAVGRALMTKPKVLMLDEPTAGVSPIVMDELFDRIIEVART-GLPILMVEQNAKQALEIA 243 Query: 212 HRAYVMVNGKVTMSGSGKELLANPEVRAAYLEG 244 + YV+V G+ +G+G+ELLA+PEVR ++L G Sbjct: 244 DKGYVLVQGRNAYTGTGQELLADPEVRKSFLGG 276 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 276 Length adjustment: 25 Effective length of query: 222 Effective length of database: 251 Effective search space: 55722 Effective search space used: 55722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory