Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate GFF3203 PGA1_c32560 high-affinity branched-chain amino acid transport ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >FitnessBrowser__Phaeo:GFF3203 Length = 278 Score = 186 bits (471), Expect = 6e-52 Identities = 103/241 (42%), Positives = 149/241 (61%), Gaps = 9/241 (3%) Query: 11 LLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKIT 70 LLEV N+ Y + +L+GV+ +V G + ++G NGAGK+T K + LL G++T Sbjct: 15 LLEVNNIEVIYNHVILVLKGVSLKVPKGGITALLGGNGAGKTTTLKAVSNLLHSERGEVT 74 Query: 71 -----FKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRND---SLQPL 122 ++G+ I ++V+ G+ V + + F L+VEENL GA+ R+D ++Q Sbjct: 75 KGSISYRGERIQDRDPAELVKKGVIQVMEGRHCFEHLTVEENLLTGAYTRSDGNANIQRD 134 Query: 123 KDKIFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQV 182 + +++ FPRL +RRR +AG SGGE+QM+AMG+ALM P ++LDEPS L+P LV Q+ Sbjct: 135 LEMVYSYFPRLKERRRSQAGYTSGGEQQMVAMGRALMSRPETILLDEPSMGLAPQLVEQI 194 Query: 183 FEQVKQINQ-EGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYL 241 FE VK IN+ EG +L EQN AL + GY+LESGR + GP EL +P V E YL Sbjct: 195 FEIVKSINENEGVTFLLAEQNTNVALRYSHYGYILESGRVVMDGPAAELRENPDVKEFYL 254 Query: 242 G 242 G Sbjct: 255 G 255 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 278 Length adjustment: 25 Effective length of query: 222 Effective length of database: 253 Effective search space: 56166 Effective search space used: 56166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory