Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate GFF1569 PGA1_c15910 putative branched-chain amino acid transport ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >FitnessBrowser__Phaeo:GFF1569 Length = 262 Score = 186 bits (472), Expect = 4e-52 Identities = 97/249 (38%), Positives = 153/249 (61%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 ++ V+ L KHFGG AV +LE+ +G + GLIGPNGAGKTTLFN++ GV P+ G VT+ Sbjct: 1 MIVVEDLHKHFGGFHAVDGASLEIAKGSITGLIGPNGAGKTTLFNVIAGVLPPTSGRVTM 60 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 DG + G P+++ GL RTFQ F +T +N+++ G+ + ++ ++ Sbjct: 61 DGEDITGLPPHELFHKGLLRTFQIAHEFASMTCRENLMMVPGSQSGESLWNTWFGRKRIA 120 Query: 123 KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGM 182 E+ L+AKA E+L+ + A+ A +S GQ++ LE+ R + + KI+FLDE AG+ Sbjct: 121 DEERALRAKADEVLEFLTISHIADLKAGQVSGGQKKLLELGRTMMVDAKIVFLDEVGAGV 180 Query: 183 NPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKTN 242 N + + I+R+ +E T ++IEHDM + + + + + G+ +AQGT DEIK N Sbjct: 181 NRTLLYTIADAIKRLNEERGYTFVVIEHDMEFIDRLCDPVICMAEGKKLAQGTLDEIKAN 240 Query: 243 KRVIEAYLG 251 ++VIEAYLG Sbjct: 241 EQVIEAYLG 249 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 262 Length adjustment: 24 Effective length of query: 230 Effective length of database: 238 Effective search space: 54740 Effective search space used: 54740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory