Align Asparagine permease (AnsP) of 497 aas and 12 TMSs (characterized)
to candidate PP_5031 PP_5031 proline (histidine) APC transporter
Query= TCDB::P40812 (497 letters) >FitnessBrowser__Putida:PP_5031 Length = 467 Score = 328 bits (841), Expect = 2e-94 Identities = 160/444 (36%), Positives = 272/444 (61%), Gaps = 5/444 (1%) Query: 24 EGYHKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGIFSFFILRALGE 83 +G + + R ++ +A+G AIGTGLF G+ + +QMAGPA+ L YLI G F ++RALGE Sbjct: 5 QGLKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVLLAYLIGGAAVFMVMRALGE 64 Query: 84 LVLHRPSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVDITAVALYMHYWGAFGDVP 143 + +H P +GSF YA +LG A ++ GW Y + I D+TA +YM +W F +V Sbjct: 65 MAVHNPVAGSFGHYATTYLGPMAGFILGWTYAFEMVIVAIADVTAFGIYMGFW--FPEVA 122 Query: 144 QWVFALGALTIVGTMNMIGVKWFAEMEFWFALIKVLAIVIFLV--VGTIFLGTGQPLEGN 201 +W++ LG + ++G +N+ VK F EMEFW +L+KV AIV ++ +G + G Q G+ Sbjct: 123 RWIWVLGIVFLIGGLNLCNVKVFGEMEFWLSLLKVGAIVAMILAGLGIMAFGFSQVGTGH 182 Query: 202 ATGFHLITDNGGFFPHGLLPALVLIQGVVFAFASIELVGTAAGECKDPQKMVPKAINSVI 261 A G + D+GGF P+G+ + V+FAF IE++G AGE KDPQ+++PKAIN+V Sbjct: 183 AVGMSNLFDHGGFMPNGVGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQRVIPKAINAVP 242 Query: 262 WRIGLFYVGSVVLLVLLLPWNAYQAGQSPFVTFFSKLGVPYIGSIMNIVVLTAALSSLNS 321 RI LFYV ++ +L+ L PW + SPFV FS LG+ +++N+VV++AA+S++NS Sbjct: 243 LRILLFYVLTLFVLMCLYPWPQIGSQGSPFVQIFSNLGIGSAAAVLNVVVISAAISAINS 302 Query: 322 GLYCTGRILRSMSMGGSAPKFMAKMSRQHVPYAGILATLVVYVVGVFLNYLVPSRVFEIV 381 ++ GR++ ++ G AP+ +K+S+ VP+ ++ ++GV LNYL+P VF ++ Sbjct: 303 DIFGAGRMMYGLAQQGHAPRGFSKLSKHGVPWMTVVVMGAALLIGVLLNYLIPENVFLLI 362 Query: 382 LNFASLGIIASWAFIMVCQMRLRQAIKEGKAADVSFKLPGAPFTSWLTLLFLLSVLVLMA 441 + A+ + W I++ Q+ +R+++ + A + F +P P+ + + F++ + ++ Sbjct: 363 ASIATFATVWVWLMILLTQVAMRRSMSREQVAQLKFPVPFWPYGPAMAIAFMVFIFGVLG 422 Query: 442 FDYPNGTYTIASLPLIAILLVAGW 465 + +P+ + + + LVA + Sbjct: 423 Y-FPDTQAALIVGVIWVVFLVASY 445 Lambda K H 0.328 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 707 Number of extensions: 49 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 467 Length adjustment: 34 Effective length of query: 463 Effective length of database: 433 Effective search space: 200479 Effective search space used: 200479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory